SCOP 1.71: Domain d1tjih2: 1tji H:114-216

Lineage for d1tjih2 (1tji H:114-216)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1tjih2: 1tji H:114-216 [112455]
   Other proteins in same PDB: d1tjih1, d1tjil1, d1tjil2
   complexed with egl, ioh, nh2, ycm

Details for d1tjih2

PDB Entry: 1tji, 2.2 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 17mer epitope

SCOP Domain Sequences for d1tjih2:

Sequence; same for both SEQRES and ATOM records:

>d1tjih2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1tjih2:

• d1tjih2 is new in SCOP 1.71
  
• d1tjih2 appears in SCOP 1.73
  
• d1tjih2 appears in the current release, SCOPe 2.08