PDB entry 1tji

View 1tji on RCSB PDB site
Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 17mer epitope
Deposited on 2004-06-04, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjiH (H:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjiL (L:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec