![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) ![]() distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation |
![]() | Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 proteins) automatically mapped to Pfam PF01619 |
![]() | Protein Proline dehydrohenase domain of bifunctional PutA protein [82280] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [82281] (7 PDB entries) Uniprot P09546 87-610 |
![]() | Domain d1tiwa2: 1tiw A:262-610 [112431] Other proteins in same PDB: d1tiwa1 complexed with fad, tfb |
PDB Entry: 1tiw (more details), 2 Å
SCOPe Domain Sequences for d1tiwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiwa2 c.1.23.2 (A:262-610) Proline dehydrohenase domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]} getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrlleng antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd
Timeline for d1tiwa2: