Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.27: Beta-galactosidase LacA, domains 4 and 5 [117111] (1 protein) duplication: tandem repeat of two similar domains; some sequence similarity to the beta-Galactosidase/glucuronidase N-terminal domain (49803) |
Protein Beta-galactosidase LacA, domains 4 and 5 [117112] (1 species) |
Species Penicillium sp. [TaxId:5081] [117113] (2 PDB entries) Uniprot Q700S9 41-1011 |
Domain d1tg7a3: 1tg7 A:849-1011 [112420] Other proteins in same PDB: d1tg7a1, d1tg7a4, d1tg7a5 complexed with edo, na, nag, po4 |
PDB Entry: 1tg7 (more details), 1.9 Å
SCOPe Domain Sequences for d1tg7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tg7a3 b.18.1.27 (A:849-1011) Beta-galactosidase LacA, domains 4 and 5 {Penicillium sp. [TaxId: 5081]} rdtvrgplnegglyaerqgfhqpqpptqkwdssspftgltkpgirfystsfdldlpsgyd iplyfnfgnststpaayrvqlyvngyqygkyvnnigpqtsfpvpegilnyhgtnwlalsl waqedngakldsfelinttpvltslgevksvnqpkyqarkgay
Timeline for d1tg7a3:
View in 3D Domains from same chain: (mouse over for more information) d1tg7a1, d1tg7a2, d1tg7a4, d1tg7a5 |