Lineage for d1teza2 (1tez A:2-204)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins)
  6. Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. Species Synechococcus elongatus [TaxId:32046] [52429] (7 PDB entries)
    Uniprot P05327 1-474
    cofactor is HDF
  8. Domain d1teza2: 1tez A:2-204 [112410]
    Other proteins in same PDB: d1teza1, d1tezb1, d1tezc1, d1tezd1
    protein/DNA complex; complexed with c, fad, g, hdf, mg, tcp

Details for d1teza2

PDB Entry: 1tez (more details), 1.8 Å

PDB Description: complex between dna and the dna photolyase from anacystis nidulans
PDB Compounds: (A:) Deoxyribodipyrimidine photolyase

SCOPe Domain Sequences for d1teza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teza2 c.28.1.1 (A:2-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]}
aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
iaplllselptlkqlgfdwdggf

SCOPe Domain Coordinates for d1teza2 are not available.

Timeline for d1teza2:

Domains from same chain:
(mouse over for more information)
d1teza1
Domains from other chains:
(mouse over for more information)
d1tezb1, d1tezb2, d1tezc1, d1tezc2, d1tezd1, d1tezd2