Lineage for d1teza2 (1tez A:2-204)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580522Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 580523Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 580524Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 580532Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 580533Species Anacystis nidulans [52429] (7 PDB entries)
    cofactor is HDF
  8. 580535Domain d1teza2: 1tez A:2-204 [112410]
    Other proteins in same PDB: d1teza1, d1tezb1, d1tezc1, d1tezd1

Details for d1teza2

PDB Entry: 1tez (more details), 1.8 Å

PDB Description: complex between dna and the dna photolyase from anacystis nidulans

SCOP Domain Sequences for d1teza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teza2 c.28.1.1 (A:2-204) DNA photolyase {Anacystis nidulans}
aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
iaplllselptlkqlgfdwdggf

SCOP Domain Coordinates for d1teza2:

Click to download the PDB-style file with coordinates for d1teza2.
(The format of our PDB-style files is described here.)

Timeline for d1teza2: