Lineage for d1td3c_ (1td3 C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139675Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) (S)
  5. 1139676Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (1 protein)
  6. 1139677Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species)
  7. 1139689Species Bacteriophage P21 [TaxId:10711] [117332] (3 PDB entries)
    Uniprot P36275
  8. 1139697Domain d1td3c_: 1td3 C: [112388]

Details for d1td3c_

PDB Entry: 1td3 (more details), 2.37 Å

PDB Description: crystal structure of vshp_bpp21 in space group c2
PDB Compounds: (C:) Head decoration protein

SCOPe Domain Sequences for d1td3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td3c_ b.85.2.1 (C:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage P21 [TaxId: 10711]}
vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
etaltyyksgtfateaihwpesvdehkkanafagsalshaalp

SCOPe Domain Coordinates for d1td3c_:

Click to download the PDB-style file with coordinates for d1td3c_.
(The format of our PDB-style files is described here.)

Timeline for d1td3c_: