Class b: All beta proteins [48724] (176 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species) elaborated with additional secondary structures; active as dimer |
Species Pseudomonas aeruginosa [TaxId:287] [117226] (1 PDB entry) Uniprot Q820A5 |
Domain d1t9mb_: 1t9m B: [112365] complexed with acy, fmn, so4 |
PDB Entry: 1t9m (more details), 1.9 Å
SCOPe Domain Sequences for d1t9mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9mb_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]} ltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqgrpstrivvia elgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlpderadaqwls rpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelclesvefwgng terlherlrydrdeggwkhrylqp
Timeline for d1t9mb_: