SCOPe 2.05: Domain d1t9mb_: 1t9m B:

Lineage for d1t9mb_ (1t9m B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Pseudomonas aeruginosa [TaxId:287] [117226] (1 PDB entry)
   Uniprot Q820A5

8. Domain d1t9mb_: 1t9m B: [112365]
   complexed with acy, fmn, so4

Details for d1t9mb_

PDB Entry: 1t9m, 1.9 Å

PDB Description: X-ray crystal structure of phzG from pseudomonas aeruginosa

PDB Compounds: (B:) probable pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d1t9mb_:

Sequence; same for both SEQRES and ATOM records:

>d1t9mb_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]}
ltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqgrpstrivvia
elgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlpderadaqwls
rpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelclesvefwgng
terlherlrydrdeggwkhrylqp

Timeline for d1t9mb_:

• d1t9mb_ first appeared in SCOP 1.71
  
• d1t9mb_ appears in SCOPe 2.04
  
• d1t9mb_ appears in SCOPe 2.06
  
• d1t9mb_ appears in the current release, SCOPe 2.08