Lineage for d1t9mb_ (1t9m B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794219Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
    elaborated with additional secondary structures; active as dimer
  7. 2794237Species Pseudomonas aeruginosa [TaxId:287] [117226] (1 PDB entry)
    Uniprot Q820A5
  8. 2794239Domain d1t9mb_: 1t9m B: [112365]
    complexed with acy, fmn, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1t9mb_

PDB Entry: 1t9m (more details), 1.9 Å

PDB Description: X-ray crystal structure of phzG from pseudomonas aeruginosa
PDB Compounds: (B:) probable pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d1t9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9mb_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]}
ltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqgrpstrivvia
elgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlpderadaqwls
rpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelclesvefwgng
terlherlrydrdeggwkhrylqp

SCOPe Domain Coordinates for d1t9mb_:

Click to download the PDB-style file with coordinates for d1t9mb_.
(The format of our PDB-style files is described here.)

Timeline for d1t9mb_: