Lineage for d1t9cb3 (1t9c B:461-687)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986732Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 986733Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species)
  7. 986734Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (6 PDB entries)
    Uniprot P07342 84-687
  8. 986742Domain d1t9cb3: 1t9c B:461-687 [112345]
    Other proteins in same PDB: d1t9ca1, d1t9ca2, d1t9cb1, d1t9cb2
    complexed with 1sm, fad, k, mg, p22, p23

Details for d1t9cb3

PDB Entry: 1t9c (more details), 2.34 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl
PDB Compounds: (B:) Acetolactate synthase, mitochondrial

SCOPe Domain Sequences for d1t9cb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9cb3 c.36.1.9 (B:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh

SCOPe Domain Coordinates for d1t9cb3:

Click to download the PDB-style file with coordinates for d1t9cb3.
(The format of our PDB-style files is described here.)

Timeline for d1t9cb3: