Lineage for d1t6sa1 (1t6s A:1-85)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907135Family a.4.5.60: ScpB/YpuH-like [116804] (1 protein)
    Pfam PF04079
    duplication: tandem repeat of two 'winged helix' domains; forms a dimer via the C-terminal domain
  6. 907136Protein Segregation and condensation protein B, ScpB [116805] (1 species)
  7. 907137Species Chlorobium tepidum [TaxId:1097] [116806] (1 PDB entry)
    Uniprot Q8KF54 1-162
  8. 907138Domain d1t6sa1: 1t6s A:1-85 [112271]
    Structural genomics target
    complexed with no3

Details for d1t6sa1

PDB Entry: 1t6s (more details), 1.95 Å

PDB Description: Crystal structure of a conserved hypothetical protein from Chlorobium tepidum
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t6sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6sa1 a.4.5.60 (A:1-85) Segregation and condensation protein B, ScpB {Chlorobium tepidum [TaxId: 1097]}
mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr
ihaiaggyrfltepefadlvrqlla

SCOPe Domain Coordinates for d1t6sa1:

Click to download the PDB-style file with coordinates for d1t6sa1.
(The format of our PDB-style files is described here.)

Timeline for d1t6sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6sa2