Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.60: ScpB/YpuH-like [116804] (1 protein) Pfam PF04079 duplication: tandem repeat of two 'winged helix' domains; forms a dimer via the C-terminal domain |
Protein Segregation and condensation protein B, ScpB [116805] (1 species) |
Species Chlorobium tepidum [TaxId:1097] [116806] (1 PDB entry) Uniprot Q8KF54 1-162 |
Domain d1t6sa1: 1t6s A:1-85 [112271] Structural genomics target complexed with no3 |
PDB Entry: 1t6s (more details), 1.95 Å
SCOPe Domain Sequences for d1t6sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6sa1 a.4.5.60 (A:1-85) Segregation and condensation protein B, ScpB {Chlorobium tepidum [TaxId: 1097]} mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr ihaiaggyrfltepefadlvrqlla
Timeline for d1t6sa1: