Lineage for d1t0nd2 (1t0n D:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897685Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 1897696Domain d1t0nd2: 1t0n D:1-181 [112209]
    Other proteins in same PDB: d1t0na1, d1t0nb_, d1t0nd1, d1t0ne_

Details for d1t0nd2

PDB Entry: 1t0n (more details), 1.8 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (D:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1t0nd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0nd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1t0nd2:

Click to download the PDB-style file with coordinates for d1t0nd2.
(The format of our PDB-style files is described here.)

Timeline for d1t0nd2: