SCOPe 2.08: Domain d1sysa2: 1sys A:1-181

Lineage for d1sysa2 (1sys A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
   Uniprot P30481 25-300

8. Domain d1sysa2: 1sys A:1-181 [112164]
   Other proteins in same PDB: d1sysa1, d1sysb_

Details for d1sysa2

PDB Entry: 1sys, 2.4 Å

PDB Description: crystal structure of hla, b*4403, and peptide eeptvikky

PDB Compounds: (A:) leukocyte antigen (HLA) class I molecule

SCOPe Domain Sequences for d1sysa2:

Sequence; same for both SEQRES and ATOM records:

>d1sysa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcveslrrylengketlq
r

Timeline for d1sysa2:

• d1sysa2 first appeared in SCOP 1.71
  
• d1sysa2 appears in SCOPe 2.07