Lineage for d1sxit_ (1sxi T:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008365Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1008366Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1008367Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1008413Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)
  7. 1008414Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 1008435Domain d1sxit_: 1sxi T: [112159]
    complexed with mg

Details for d1sxit_

PDB Entry: 1sxi (more details), 3 Å

PDB Description: Structure of apo transcription regulator B. megaterium
PDB Compounds: (T:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1sxit_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxit_ c.93.1.1 (T:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d1sxit_:

Click to download the PDB-style file with coordinates for d1sxit_.
(The format of our PDB-style files is described here.)

Timeline for d1sxit_: