![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.245: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102847] (1 superfamily) beta(3)-alpha(2)-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other |
![]() | Superfamily d.245.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102848] (1 family) ![]() |
![]() | Family d.245.1.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102849] (1 protein) |
![]() | Protein NSFL1 (p97 ATPase) cofactor p47, SEP domain [102850] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117860] (1 PDB entry) Uniprot Q9UNZ2 171-270 |
![]() | Domain d1ss6a1: 1ss6 A:3-102 [112112] Other proteins in same PDB: d1ss6a2 includes linker to the UBX domain |
PDB Entry: 1ss6 (more details)
SCOPe Domain Sequences for d1ss6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ss6a1 d.245.1.1 (A:3-102) NSFL1 (p97 ATPase) cofactor p47, SEP domain {Human (Homo sapiens) [TaxId: 9606]} ekrqhssqdvhvvlklwksgfsldngelrsyqdpsnaqflesirrgevpaelrrlahggq vnldmedhrdedfvkpkgafkaftgegqklgstapqvlst
Timeline for d1ss6a1: