Lineage for d1ss6a1 (1ss6 A:3-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008655Fold d.245: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102847] (1 superfamily)
    beta(3)-alpha(2)-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other
  4. 3008656Superfamily d.245.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102848] (1 family) (S)
  5. 3008657Family d.245.1.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102849] (1 protein)
  6. 3008658Protein NSFL1 (p97 ATPase) cofactor p47, SEP domain [102850] (2 species)
  7. 3008659Species Human (Homo sapiens) [TaxId:9606] [117860] (1 PDB entry)
    Uniprot Q9UNZ2 171-270
  8. 3008660Domain d1ss6a1: 1ss6 A:3-102 [112112]
    Other proteins in same PDB: d1ss6a2
    includes linker to the UBX domain

Details for d1ss6a1

PDB Entry: 1ss6 (more details)

PDB Description: solution structure of sep domain from human p47
PDB Compounds: (A:) NSFL1 cofactor p47

SCOPe Domain Sequences for d1ss6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ss6a1 d.245.1.1 (A:3-102) NSFL1 (p97 ATPase) cofactor p47, SEP domain {Human (Homo sapiens) [TaxId: 9606]}
ekrqhssqdvhvvlklwksgfsldngelrsyqdpsnaqflesirrgevpaelrrlahggq
vnldmedhrdedfvkpkgafkaftgegqklgstapqvlst

SCOPe Domain Coordinates for d1ss6a1:

Click to download the PDB-style file with coordinates for d1ss6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ss6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ss6a2