Lineage for d1ss6a_ (1ss6 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616778Fold d.245: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102847] (1 superfamily)
    beta(3)-alpha(2)-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other
  4. 616779Superfamily d.245.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102848] (1 family) (S)
  5. 616780Family d.245.1.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102849] (1 protein)
  6. 616781Protein NSFL1 (p97 ATPase) cofactor p47, SEP domain [102850] (2 species)
  7. 616782Species Human (Homo sapiens) [TaxId:9606] [117860] (1 PDB entry)
  8. 616783Domain d1ss6a_: 1ss6 A: [112112]
    includes linker to the UBX domain

Details for d1ss6a_

PDB Entry: 1ss6 (more details)

PDB Description: solution structure of sep domain from human p47

SCOP Domain Sequences for d1ss6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ss6a_ d.245.1.1 (A:) NSFL1 (p97 ATPase) cofactor p47, SEP domain {Human (Homo sapiens)}
gsekrqhssqdvhvvlklwksgfsldngelrsyqdpsnaqflesirrgevpaelrrlahg
gqvnldmedhrdedfvkpkgafkaftgegqklgstapqvlst

SCOP Domain Coordinates for d1ss6a_:

Click to download the PDB-style file with coordinates for d1ss6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ss6a_: