Lineage for d1sdea_ (1sde A:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742174Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)
  6. 742444Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 742453Species Streptomyces sp., R61 [TaxId:1931] [56605] (15 PDB entries)
  8. 742459Domain d1sdea_: 1sde A: [112073]
    complexed with 2pb, gol

Details for d1sdea_

PDB Entry: 1sde (more details), 1.15 Å

PDB Description: Toward Better Antibiotics: Crystal Structure Of D-Ala-D-Ala Peptidase inhibited by a novel bicyclic phosphate inhibitor
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOP Domain Sequences for d1sdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdea_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOP Domain Coordinates for d1sdea_:

Click to download the PDB-style file with coordinates for d1sdea_.
(The format of our PDB-style files is described here.)

Timeline for d1sdea_: