![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species) |
![]() | Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries) Uniprot P15555 34-378 ! Uniprot P15555 |
![]() | Domain d1sdea_: 1sde A: [112073] complexed with 2pb, gol |
PDB Entry: 1sde (more details), 1.15 Å
SCOPe Domain Sequences for d1sdea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sdea_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]} lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp
Timeline for d1sdea_: