Lineage for d1s57b_ (1s57 B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861820Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 861821Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 861822Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 862030Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries)
    Uniprot O64903 79-231
  8. 862032Domain d1s57b_: 1s57 B: [112029]

Details for d1s57b_

PDB Entry: 1s57 (more details), 1.8 Å

PDB Description: crystal structure of nucleoside diphosphate kinase 2 from Arabidopsis
PDB Compounds: (B:) Nucleoside diphosphate kinase II

SCOP Domain Sequences for d1s57b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s57b_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]}
veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
engkreiglwfkegelckwdsalatwlre

SCOP Domain Coordinates for d1s57b_:

Click to download the PDB-style file with coordinates for d1s57b_.
(The format of our PDB-style files is described here.)

Timeline for d1s57b_: