| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins) |
| Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species) |
| Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries) Uniprot P46828 58-322 ! Uniprot P46828 |
| Domain d1rzra2: 1rzr A:61-332 [111990] Other proteins in same PDB: d1rzra1, d1rzrc1, d1rzrd1, d1rzrg1, d1rzrl_, d1rzrs_, d1rzrt_, d1rzry_ protein/DNA complex; complexed with mg, so4 |
PDB Entry: 1rzr (more details), 2.8 Å
SCOPe Domain Sequences for d1rzra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzra2 c.93.1.1 (A:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
amrlltkymnketvdssivqlphriefrqstk
Timeline for d1rzra2: