| Class b: All beta proteins [48724] (174 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
| Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (3 PDB entries) Uniprot P06750 303-564 |
| Domain d1rzob2: 1rzo B:2136-2262 [111985] Other proteins in same PDB: d1rzoa_, d1rzoc_ complexed with gal, so4 |
PDB Entry: 1rzo (more details), 2.63 Å
SCOPe Domain Sequences for d1rzob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzob2 b.42.2.1 (B:2136-2262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
ntqpfvttivglygmclqansgkvwledctsekaeqqwalyadgsirpqqnrdnclttda
nikgtvvkilscgpassgqrwmfkndgtilnlynglvldvrrsdpslkqiivhpfhgnln
qiwlplf
Timeline for d1rzob2:
View in 3DDomains from other chains: (mouse over for more information) d1rzoa_, d1rzoc_, d1rzod1, d1rzod2 |