SCOPe 2.08: Domain d1rzob2: 1rzo B:2136-2262

Lineage for d1rzob2 (1rzo B:2136-2262)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (4 PDB entries)
   Uniprot P06750 303-564

8. Domain d1rzob2: 1rzo B:2136-2262 [111985]
   Other proteins in same PDB: d1rzoa_, d1rzoc_
   complexed with gal, so4

Details for d1rzob2

PDB Entry: 1rzo, 2.63 Å

PDB Description: agglutinin from ricinus communis with galactoaza

PDB Compounds: (B:) agglutinin

SCOPe Domain Sequences for d1rzob2:

Sequence; same for both SEQRES and ATOM records:

>d1rzob2 b.42.2.1 (B:2136-2262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
ntqpfvttivglygmclqansgkvwledctsekaeqqwalyadgsirpqqnrdnclttda
nikgtvvkilscgpassgqrwmfkndgtilnlynglvldvrrsdpslkqiivhpfhgnln
qiwlplf

Timeline for d1rzob2:

• d1rzob2 first appeared in SCOP 1.71
  
• d1rzob2 appears in SCOPe 2.07