Lineage for d1rutx1 (1rut X:19-48)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065569Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 1065642Protein LIM only 4 (Lmo4) [90205] (1 species)
  7. 1065643Species Mouse (Mus musculus) [TaxId:10090] [90206] (2 PDB entries)
    Uniprot P61969 19-152
  8. 1065644Domain d1rutx1: 1rut X:19-48 [111939]
    fusion protein with the LIM domain-binding protein 1 region (Uniprot P70662 300-327)
    complexed with zn

Details for d1rutx1

PDB Entry: 1rut (more details), 1.3 Å

PDB Description: complex of lmo4 lim domains 1 and 2 with the ldb1 lid domain
PDB Compounds: (X:) Fusion protein of Lmo4 protein and LIM domain-binding protein 1

SCOPe Domain Sequences for d1rutx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]}
swkrcagcggkiadrfllyamdsywhsrcl

SCOPe Domain Coordinates for d1rutx1:

Click to download the PDB-style file with coordinates for d1rutx1.
(The format of our PDB-style files is described here.)

Timeline for d1rutx1: