Lineage for d1rtka1 (1rtk A:453-739)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056429Protein Factor B [50561] (1 species)
  7. 2056430Species Human (Homo sapiens) [TaxId:9606] [50562] (4 PDB entries)
    Uniprot P00751 268-764
  8. 2056434Domain d1rtka1: 1rtk A:453-739 [111932]
    Other proteins in same PDB: d1rtka2
    complexed with gbs, iod, mg, na

Details for d1rtka1

PDB Entry: 1rtk (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of the Bb segment of Factor B complexed with 4-guanidinobenzoic acid
PDB Compounds: (A:) complement factor b

SCOPe Domain Sequences for d1rtka1:

Sequence, based on SEQRES records: (download)

>d1rtka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]}
cgmvwehrkgtdyhkqpwqakisvirpskghescmgavvseyfvltaahcftvddkehsi
kvsvggekrdleievvlfhpnyningkkeagipefydydvaliklknklkygqtirpicl
pctegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevyikngdkkgsce
rdaqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivhkrsrfiqvgvi
swgvvdvcknqkrqkqvpahardfhinlfqvlpwlkeklqdedlgfl

Sequence, based on observed residues (ATOM records): (download)

>d1rtka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]}
cgmvwehrkgtdyhkqpwqakisvirkghescmgavvseyfvltaahcftvddkehsikv
svggekrdleievvlfhpnyningkkeagipefydydvaliklknklkygqtirpiclpc
tegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevyikngdkkgscerd
aqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivhkrsrfiqvgvisw
gvvdvckrqkqvpahardfhinlfqvlpwlkeklqdedlgfl

SCOPe Domain Coordinates for d1rtka1:

Click to download the PDB-style file with coordinates for d1rtka1.
(The format of our PDB-style files is described here.)

Timeline for d1rtka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rtka2