SCOPe 2.07: Domain d1rqab_: 1rqa B:

Lineage for d1rqab_ (1rqa B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries)
   Uniprot P68871

8. Domain d1rqab_: 1rqa B: [111911]
   Other proteins in same PDB: d1rqaa_, d1rqac_
   complexed with hem, no

Details for d1rqab_

PDB Entry: 1rqa, 2.11 Å

PDB Description: crystallographic analysis of the interaction of nitric oxide with quaternary-t human hemoglobin. beta w73e hemoglobin exposed to no under anaerobic conditions

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1rqab_:

Sequence; same for both SEQRES and ATOM records:

>d1rqab_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypetqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1rqab_:

• d1rqab_ first appeared in SCOP 1.71
  
• d1rqab_ appears in SCOPe 2.06
  
• d1rqab_ appears in the current release, SCOPe 2.08