Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin automatically mapped to Pfam PF03767 |
Protein Class B acid phosphatase, AphA [102308] (2 species) |
Species Escherichia coli [TaxId:562] [102309] (13 PDB entries) Uniprot P32697 27-237 |
Domain d1rmta_: 1rmt A: [111888] complexed with adn, mg |
PDB Entry: 1rmt (more details), 1.4 Å
SCOPe Domain Sequences for d1rmta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rmta_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} psplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkkt fspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetv sktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgarg irilrasnstykplpqagafgeevivnsey
Timeline for d1rmta_: