Lineage for d1rmtd_ (1rmt D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920045Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 2920046Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 2920047Species Escherichia coli [TaxId:562] [102309] (13 PDB entries)
    Uniprot P32697 27-237
  8. 2920055Domain d1rmtd_: 1rmt D: [111891]
    complexed with adn, mg

Details for d1rmtd_

PDB Entry: 1rmt (more details), 1.4 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase complexed with adenosine.
PDB Compounds: (D:) Class B acid phosphatase

SCOPe Domain Sequences for d1rmtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmtd_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d1rmtd_:

Click to download the PDB-style file with coordinates for d1rmtd_.
(The format of our PDB-style files is described here.)

Timeline for d1rmtd_: