SCOPe 2.01: Domain d1ritc_: 1rit C:

Lineage for d1ritc_ (1rit C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
   Uniprot P02872 24-255

8. Domain d1ritc_: 1rit C: [111817]
   complexed with ca, lat, mn, sfp

Details for d1ritc_

PDB Entry: 1rit, 2.85 Å

PDB Description: crystal structure of peanut lectin in complex with meso- tetrasulphonatophenylporphyrin and lactose

PDB Compounds: (C:) Galactose-binding lectin

SCOPe Domain Sequences for d1ritc_:

Sequence; same for both SEQRES and ATOM records:

>d1ritc_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d1ritc_:

• d1ritc_ first appeared in SCOP 1.71
  
• d1ritc_ appears in SCOP 1.75
  
• d1ritc_ appears in SCOPe 2.02
  
• d1ritc_ appears in the current release, SCOPe 2.08