SCOPe 2.08: Domain d1rg8b1: 1rg8 B:1-137

Lineage for d1rg8b1 (1rg8 B:1-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1rg8b1: 1rg8 B:1-137 [111802]
   Other proteins in same PDB: d1rg8a2, d1rg8b2
   complexed with fmt

Details for d1rg8b1

PDB Entry: 1rg8, 1.1 Å

PDB Description: human acidic fibroblast growth factor (hafgf-1) at 1.10 angstrom resolution (140 amino acid form)

PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1rg8b1:

Sequence; same for both SEQRES and ATOM records:

>d1rg8b1 b.42.1.1 (B:1-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
prthygqkailflplpv

Timeline for d1rg8b1:

• d1rg8b1 first appeared in SCOP 1.71, called d1rg8b_
  
• d1rg8b1 appears in SCOPe 2.07