Lineage for d1rg6a_ (1rg6 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272204Protein C-terminal domain of p63 [116934] (1 species)
  7. 1272205Species Human (Homo sapiens) [TaxId:9606] [116935] (1 PDB entry)
    Uniprot Q9H3D4 544-610
  8. 1272206Domain d1rg6a_: 1rg6 A: [111800]

Details for d1rg6a_

PDB Entry: 1rg6 (more details)

PDB Description: solution structure of the c-terminal domain of p63
PDB Compounds: (A:) second splice variant p63

SCOPe Domain Sequences for d1rg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]}
ptdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgild
hrqlhef

SCOPe Domain Coordinates for d1rg6a_:

Click to download the PDB-style file with coordinates for d1rg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1rg6a_: