Lineage for d1rd5a_ (1rd5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827224Protein Trp synthase alpha-subunit [51388] (9 species)
  7. 2827231Species Maize (Zea mays) [TaxId:4577] [117361] (2 PDB entries)
    Uniprot P42390
  8. 2827232Domain d1rd5a_: 1rd5 A: [111772]
    complexed with mla

Details for d1rd5a_

PDB Entry: 1rd5 (more details), 2.02 Å

PDB Description: crystal structure of tryptophan synthase alpha chain homolog bx1: a member of the chemical plant defense system
PDB Compounds: (A:) Tryptophan synthase alpha chain, chloroplast

SCOPe Domain Sequences for d1rd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}
srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyykpimfrslakmkeagvhg
livpdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgp
ranvnprvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaa
spkqglrrleeyargmknalg

SCOPe Domain Coordinates for d1rd5a_:

Click to download the PDB-style file with coordinates for d1rd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rd5a_: