Lineage for d1r9pa_ (1r9p A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686645Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1686646Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1686661Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 1686672Protein NifU-like protein HI0377 [102929] (1 species)
  7. 1686673Species Haemophilus influenzae [TaxId:727] [102930] (2 PDB entries)
    Uniprot Q57074
  8. 1686674Domain d1r9pa_: 1r9p A: [111728]
    Structural genomics target
    complexed with zn

Details for d1r9pa_

PDB Entry: 1r9p (more details)

PDB Description: Solution NMR Structure Of The Haemophilus Influenzae Iron-Sulfur Cluster Assembly Protein U (IscU) with Zinc Bound at the Active Site. Northeast Structural Genomics Consortium Target IR24.
PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d1r9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9pa_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]}
maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfkt
ygcgsaiassslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiad
ykakqglehhhhhh

SCOPe Domain Coordinates for d1r9pa_:

Click to download the PDB-style file with coordinates for d1r9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1r9pa_: