Lineage for d1r8pb_ (1r8p B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724702Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 724703Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 724710Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 724718Species Human papillomavirus type 16 [TaxId:333760] [54962] (3 PDB entries)
  8. 724723Domain d1r8pb_: 1r8p B: [111721]

Details for d1r8pb_

PDB Entry: 1r8p (more details)

PDB Description: hpv-16 e2c solution structure
PDB Compounds: (B:) Regulatory protein E2

SCOP Domain Sequences for d1r8pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8pb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

SCOP Domain Coordinates for d1r8pb_:

Click to download the PDB-style file with coordinates for d1r8pb_.
(The format of our PDB-style files is described here.)

Timeline for d1r8pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r8pa_