SCOP 1.73: Domain d1r8pb_: 1r8p B:

Lineage for d1r8pb_ (1r8p B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 16 [TaxId:333760] [54962] (3 PDB entries)

8. Domain d1r8pb_: 1r8p B: [111721]

Details for d1r8pb_

PDB Entry: 1r8p

PDB Description: hpv-16 e2c solution structure

PDB Compounds: (B:) Regulatory protein E2

SCOP Domain Sequences for d1r8pb_:

Sequence; same for both SEQRES and ATOM records:

>d1r8pb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

Timeline for d1r8pb_:

• d1r8pb_ first appeared in SCOP 1.71
  
• d1r8pb_ appears in SCOP 1.75
  
• d1r8pb_ appears in the current release, SCOPe 2.08