| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
| Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins) |
| Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
| Species Human papillomavirus type 16 [TaxId:333760] [54962] (2 PDB entries) |
| Domain d1r8pa_: 1r8p A: [111720] |
PDB Entry: 1r8p (more details)
SCOP Domain Sequences for d1r8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8pa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi
Timeline for d1r8pa_: