SCOP 1.71: Domain d1r8pa_: 1r8p A:

Lineage for d1r8pa_ (1r8p A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 16 [TaxId:333760] [54962] (2 PDB entries)

8. Domain d1r8pa_: 1r8p A: [111720]

Details for d1r8pa_

PDB Entry: 1r8p

PDB Description: hpv-16 e2c solution structure

SCOP Domain Sequences for d1r8pa_:

Sequence; same for both SEQRES and ATOM records:

>d1r8pa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

Timeline for d1r8pa_:

• d1r8pa_ is new in SCOP 1.71
  
• d1r8pa_ appears in SCOP 1.73
  
• d1r8pa_ appears in the current release, SCOPe 2.08