Lineage for d1r3da1 (1r3d A:2-263)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135999Family c.69.1.35: Hypothetical protein VC1974 [117717] (1 protein)
    automatically mapped to Pfam PF00561
    automatically mapped to Pfam PF12697
  6. 2136000Protein Hypothetical protein VC1974 [117718] (1 species)
  7. 2136001Species Vibrio cholerae [TaxId:666] [117719] (1 PDB entry)
    Uniprot Q9KQM4
  8. 2136002Domain d1r3da1: 1r3d A:2-263 [111680]
    Other proteins in same PDB: d1r3da2
    Structural genomics target

Details for d1r3da1

PDB Entry: 1r3d (more details), 1.9 Å

PDB Description: Crystal structure of protein VC1974 from Vibrio cholerae, Pfam abhydrolase
PDB Compounds: (A:) conserved hypothetical protein VC1974

SCOPe Domain Sequences for d1r3da1:

Sequence, based on SEQRES records: (download)

>d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}
lsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnperhc
dnfaeavemieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghf
glqeneekaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlg
ssvahmllatslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghn
vhheqpqafakivqamihsiid

Sequence, based on observed residues (ATOM records): (download)

>d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}
lsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnpaeav
emieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghfglqenee
kaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlgssvahml
latslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghnvhheqpq
afakivqamihsiid

SCOPe Domain Coordinates for d1r3da1:

Click to download the PDB-style file with coordinates for d1r3da1.
(The format of our PDB-style files is described here.)

Timeline for d1r3da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r3da2