PDB entry 1r3d

View 1r3d on RCSB PDB site
Description: Crystal structure of protein VC1974 from Vibrio cholerae, Pfam abhydrolase
Class: structural genomics, unknown function
Keywords: Structural Genomics, Hydrolase, NYSGXRC, New York SGX Research Center for Structural Genomics, PSI, protein structure initiative, UNKNOWN FUNCTION
Deposited on 2003-10-01, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein VC1974
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC1974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQM4 (2-263)
      • cloning artifact (0-1)
      • modified residue (70)
      • modified residue (98)
      • modified residue (187)
      • modified residue (257)
    Domains in SCOPe 2.08: d1r3da1, d1r3da2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r3dA (A:)
    sllsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnper
    hcdnfaeavemieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegg
    hfglqeneekaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsan
    lgssvahmllatslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqag
    hnvhheqpqafakivqamihsiid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3dA (A:)
    sllsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnpae
    avemieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghfglqen
    eekaarwqhdqqwaqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlgssvah
    mllatslakqpyllpalqalklpihyvcgeqdskfqqlaessglsysqvaqaghnvhheq
    pqafakivqamihsiid