SCOPe 2.01: Domain d1r38c_: 1r38 C:

Lineage for d1r38c_ (1r38 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Xylose reductase [75058] (1 species)

7. Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
   Uniprot O74237

8. Domain d1r38c_: 1r38 C: [111678]
   complexed with nap; mutant

Details for d1r38c_

PDB Entry: 1r38, 2.2 Å

PDB Description: crystal structure of h114a mutant of candida tenuis xylose reductase

PDB Compounds: (C:) xylose reductase

SCOPe Domain Sequences for d1r38c_:

Sequence; same for both SEQRES and ATOM records:

>d1r38c_ c.1.7.1 (C:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

Timeline for d1r38c_:

• d1r38c_ first appeared in SCOP 1.71
  
• d1r38c_ appears in SCOP 1.75
  
• d1r38c_ appears in SCOPe 2.02
  
• d1r38c_ appears in the current release, SCOPe 2.08