Lineage for d1q13a_ (1q13 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817590Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)
  7. 1817593Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110348] (2 PDB entries)
    Uniprot P80508
  8. 1817596Domain d1q13a_: 1q13 A: [111648]
    complexed with nap, so4, tes

Details for d1q13a_

PDB Entry: 1q13 (more details), 2.08 Å

PDB Description: crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with nadp and testosterone
PDB Compounds: (A:) Prostaglandin-E2 9-reductase

SCOPe Domain Sequences for d1q13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q13a_ c.1.7.1 (A:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
nfryvtadfaighpnypfsdey

SCOPe Domain Coordinates for d1q13a_:

Click to download the PDB-style file with coordinates for d1q13a_.
(The format of our PDB-style files is described here.)

Timeline for d1q13a_: