|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like | 
|  | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)  binds cofactor molecules in the opposite direction than classical Rossmann fold | 
|  | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold | 
|  | Protein Benzoylformate decarboxylase [52482] (1 species) | 
|  | Species Pseudomonas putida [TaxId:303] [52483] (34 PDB entries) Uniprot P20906 | 
|  | Domain d1po7a1: 1po7 A:182-341 [111636] Other proteins in same PDB: d1po7a2, d1po7a3 complexed with ca, mg, tzd; mutant | 
PDB Entry: 1po7 (more details), 1.2 Å
SCOPe Domain Sequences for d1po7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1po7a1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d1po7a1: