Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins) |
Protein Potassium channel-related protein MthK [75122] (1 species) |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (2 PDB entries) |
Domain d1lnqf3: 1lnq F:116-244 [111586] Other proteins in same PDB: d1lnqa2, d1lnqa4, d1lnqb2, d1lnqb4, d1lnqc2, d1lnqc4, d1lnqd2, d1lnqd4, d1lnqe2, d1lnqe4, d1lnqf2, d1lnqf4, d1lnqg2, d1lnqg4, d1lnqh2, d1lnqh4 complexed with ca |
PDB Entry: 1lnq (more details), 3.3 Å
SCOPe Domain Sequences for d1lnqf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnqf3 c.2.1.9 (F:116-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]} rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis grlmsrsid
Timeline for d1lnqf3: