Lineage for d1xcbb1 (1xcb B:4-77)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533790Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. 533791Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. 533792Species Thermus aquaticus [TaxId:271] [101009] (1 PDB entry)
  8. 533794Domain d1xcbb1: 1xcb B:4-77 [109554]
    Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2

Details for d1xcbb1

PDB Entry: 1xcb (more details), 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

SCOP Domain Sequences for d1xcbb1:

Sequence, based on SEQRES records: (download)

>d1xcbb1 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records): (download)

>d1xcbb1 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsgytvpvlkr
elrhilgl

SCOP Domain Coordinates for d1xcbb1:

Click to download the PDB-style file with coordinates for d1xcbb1.
(The format of our PDB-style files is described here.)

Timeline for d1xcbb1: