SCOPe 2.08: Domain d1xcbb1: 1xcb B:4-77

Lineage for d1xcbb1 (1xcb B:4-77)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)

6. Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
   AT-rich DNA-binding protein p25

7. Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
   Uniprot Q9X2V5; # CASP5

8. Domain d1xcbb1: 1xcb B:4-77 [109554]
   Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2
   protein/DNA complex; complexed with ca, nad

Details for d1xcbb1

PDB Entry: 1xcb, 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

PDB Compounds: (B:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d1xcbb1:

Sequence, based on SEQRES records:

>d1xcbb1 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records):

>d1xcbb1 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsgytvpvlkr
elrhilgl

Timeline for d1xcbb1:

• d1xcbb1 first appeared in SCOP 1.69
  
• d1xcbb1 appears in SCOPe 2.07