SCOPe 2.06: Domain d1xa1b_: 1xa1 B:

Lineage for d1xa1b_ (1xa1 B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein Regulatory protein BlaR1 [111289] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [111290] (3 PDB entries)
   Uniprot P18357 338-582 ! Uniprot P18357 334-581 ! Uniprot P18357 338-583

8. Domain d1xa1b_: 1xa1 B: [109530]
   complexed with po4, pop

Details for d1xa1b_

PDB Entry: 1xa1, 1.8 Å

PDB Description: Crystal structure of the sensor domain of BlaR1 from Staphylococcus aureus in its apo form

PDB Compounds: (B:) regulatory protein blar1

SCOPe Domain Sequences for d1xa1b_:

Sequence; same for both SEQRES and ATOM records:

>d1xa1b_ e.3.1.1 (B:) Regulatory protein BlaR1 {Staphylococcus aureus [TaxId: 1280]}
nykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiylam
fgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatq
lkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllikk
nekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilk
emgvln

Timeline for d1xa1b_:

• d1xa1b_ first appeared in SCOP 1.69
  
• d1xa1b_ appears in SCOPe 2.05
  
• d1xa1b_ appears in SCOPe 2.07
  
• d1xa1b_ appears in the current release, SCOPe 2.08