Lineage for d1wora1 (1wor A:279-362)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2794092Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 2794093Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 2794094Protein Glycine cleavage system T protein, GcvT [110231] (4 species)
  7. 2794103Species Thermotoga maritima [TaxId:2336] [110232] (4 PDB entries)
    Uniprot Q9WY54
  8. 2794105Domain d1wora1: 1wor A:279-362 [109466]
    Other proteins in same PDB: d1wora2
    complexed with red

Details for d1wora1

PDB Entry: 1wor (more details), 1.95 Å

PDB Description: Crystal Structure of T-protein of the Glycine Cleavage System
PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1wora1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wora1 b.44.2.1 (A:279-362) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]}
rklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgv
vfpggklvealvvkkpfyrgsvrr

SCOPe Domain Coordinates for d1wora1:

Click to download the PDB-style file with coordinates for d1wora1.
(The format of our PDB-style files is described here.)

Timeline for d1wora1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wora2