Lineage for d1wora1 (1wor A:279-362)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) 
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) 
Protein Glycine cleavage system T protein, GcvT [110231] (2 species) 
Species Thermotoga maritima [TaxId:243274] [110232] (4 PDB entries) 
Domain d1wora1: 1wor A:279-362 [109466]
Other proteins in same PDB: d1wora2
Details for d1wora1
PDB Entry: 1wor (more details), 1.95 Å
PDB Description: Crystal Structure of T-protein of the Glycine Cleavage System
SCOP Domain Sequences for d1wora1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wora1 b.44.2.1 (A:279-362) Glycine cleavage system T protein, GcvT {Thermotoga maritima}
rklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgv
vfpggklvealvvkkpfyrgsvrr
SCOP Domain Coordinates for d1wora1:
Click to download the PDB-style file with coordinates for d1wora1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wora1:
- d1wora1 is new in SCOP 1.69
- d1wora1 appears in SCOP 1.71
- d1wora1 appears in the current release, SCOPe 2.08
View in 3D
