![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
![]() | Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species) |
![]() | Species Arthrobacter sp. KM [TaxId:184230] [110638] (1 PDB entry) Uniprot Q7WT42 11-263 # Fragment |
![]() | Domain d1woqa2: 1woq A:140-263 [109463] complexed with bgc, po4 |
PDB Entry: 1woq (more details), 1.8 Å
SCOPe Domain Sequences for d1woqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woqa2 c.55.1.10 (A:140-263) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} vkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarerdglswdeys vllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrneagivgaaiei alqh
Timeline for d1woqa2: