SCOP 1.75: Domain d1wmzc_: 1wmz C:

Lineage for d1wmzc_ (1wmz C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Lectin CEL-I [111262] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
   Uniprot Q7M462

8. Domain d1wmzc_: 1wmz C: [109424]

Details for d1wmzc_

PDB Entry: 1wmz, 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine

PDB Compounds: (C:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOP Domain Sequences for d1wmzc_:

Sequence; same for both SEQRES and ATOM records:

>d1wmzc_ d.169.1.1 (C:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

Timeline for d1wmzc_:

• d1wmzc_ first appeared in SCOP 1.69
  
• d1wmzc_ appears in SCOP 1.73
  
• d1wmzc_ appears in SCOPe 2.01
  
• d1wmzc_ appears in the current release, SCOPe 2.08