Lineage for d1wmzc_ (1wmz C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514332Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
    Pfam 00059
  6. 514405Protein Lectin CEL-I [111262] (1 species)
  7. 514406Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
  8. 514409Domain d1wmzc_: 1wmz C: [109424]

Details for d1wmzc_

PDB Entry: 1wmz (more details), 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine

SCOP Domain Sequences for d1wmzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmzc_ d.169.1.1 (C:) Lectin CEL-I {Cucumaria echinata}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

SCOP Domain Coordinates for d1wmzc_:

Click to download the PDB-style file with coordinates for d1wmzc_.
(The format of our PDB-style files is described here.)

Timeline for d1wmzc_: