SCOPe 2.07: Domain d1wmub_: 1wmu B:

Lineage for d1wmub_ (1wmu B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (3 PDB entries)
   Uniprot P83133

8. Domain d1wmub_: 1wmu B: [109417]
   Other proteins in same PDB: d1wmua_
   complexed with hem

Details for d1wmub_

PDB Entry: 1wmu, 1.65 Å

PDB Description: Crystal Structure of Hemoglobin D from the Aldabra Giant Tortoise, Geochelone gigantea, at 1.65 A resolution

PDB Compounds: (B:) Hemoglobin A and D beta chain

SCOPe Domain Sequences for d1wmub_:

Sequence; same for both SEQRES and ATOM records:

>d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
eftpasqaawtklvnavahalalgyh

Timeline for d1wmub_:

• d1wmub_ first appeared in SCOP 1.69
  
• d1wmub_ appears in SCOPe 2.06
  
• d1wmub_ appears in the current release, SCOPe 2.08