![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (3 PDB entries) Uniprot P83133 |
![]() | Domain d1wmub_: 1wmu B: [109417] Other proteins in same PDB: d1wmua_ complexed with hem |
PDB Entry: 1wmu (more details), 1.65 Å
SCOPe Domain Sequences for d1wmub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk eftpasqaawtklvnavahalalgyh
Timeline for d1wmub_: