SCOPe 2.08: Domain d1wd4a1: 1wd4 A:19-337

Lineage for d1wd4a1 (1wd4 A:19-337)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
   automatically mapped to Pfam PF09206

6. Protein Alpha-L-arabinofuranosidase B, N-terminal domain [110144] (1 species)

7. Species Aspergillus kawachii [TaxId:40384] [110145] (2 PDB entries)
   Uniprot Q8NK89 19-499

8. Domain d1wd4a1: 1wd4 A:19-337 [109235]
   Other proteins in same PDB: d1wd4a2
   complexed with ahr

Details for d1wd4a1

PDB Entry: 1wd4, 2.07 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinose

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d1wd4a1:

Sequence; same for both SEQRES and ATOM records:

>d1wd4a1 b.29.1.21 (A:19-337) Alpha-L-arabinofuranosidase B, N-terminal domain {Aspergillus kawachii [TaxId: 40384]}
gpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaqd
tfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkaygv
fmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmeai
ylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwair
ganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgypsd
dtensvqenivaakyvvgs

Timeline for d1wd4a1:

• d1wd4a1 first appeared in SCOP 1.69
  
• d1wd4a1 appears in SCOPe 2.07